SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383785930|ref|YP_005470499.1| from Fervidobacterium pennivorans DSM 9078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383785930|ref|YP_005470499.1|
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.43e-42
Family Single strand DNA-binding domain, SSB 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383785930|ref|YP_005470499.1|
Sequence length 136
Comment single stranded DNA-binding protein [Fervidobacterium pennivorans DSM 9078]
Sequence
MSYNKVVLVGRLTRDPETRQTIDGNLVTTFTIAVNRGTNGDEADFIRIVAFRKLAELAHN
YLQKGRMVLVDGKLRINKWKTNDGQTRSTVEIWADNIVFVDSRKSDKEIPEEIPYEEVFG
EDIEEEDIPNDDEPPF
Download sequence
Identical sequences H9UA37
gi|383785930|ref|YP_005470499.1| WP_014450848.1.64957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]