SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383785933|ref|YP_005470502.1| from Fervidobacterium pennivorans DSM 9078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383785933|ref|YP_005470502.1|
Domain Number 1 Region: 6-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.47e-49
Family G proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 177-286
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 4.25e-40
Family Prokaryotic type KH domain (KH-domain type II) 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383785933|ref|YP_005470502.1|
Sequence length 298
Comment GTP-binding protein Era [Fervidobacterium pennivorans DSM 9078]
Sequence
MKSGFVSFVGKPNVGKSSIINAIMKKKVVIVSDKPQTTRNRINVIYTDSDAQIIFVDTPG
IHKPLHRLGEYMVKAAVQALKNVDLLLFTIDAKEGFETPEEHISNYINQSETPTIGVINK
IDLVDNDRADLIEEQIRSHVNNLLDVVRTSAVTGEGLNELVEKIKQHLPEGPQLYPEDII
VDRPLSFIASELIREKIFHFTYEEIPHSVAVIVEEVKERPNGVVYIRANIYVERESQKGI
IIGQEGRMIKKIGESARKDIEYFLGSKVYLDLHVKVKKDWRNKDFIILNEVGMRDDLD
Download sequence
Identical sequences H9UA40
gi|383785933|ref|YP_005470502.1| WP_014450851.1.64957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]