SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383786401|ref|YP_005470970.1| from Fervidobacterium pennivorans DSM 9078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383786401|ref|YP_005470970.1|
Domain Number 1 Region: 66-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.2e-28
Family Extended AAA-ATPase domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383786401|ref|YP_005470970.1|
Sequence length 254
Comment DNA replication protein [Fervidobacterium pennivorans DSM 9078]
Sequence
MSNYVKLLNNLEELGLHNIKNNLDKYLDLVASGEKSMTDALYELSNLEIKAKEERAILGC
VRVANFPFIKGIEDFDFSFQPSINKQQIMDLMSLRFLEGNENILFVGTPGVGKTHLATAI
GIECAKRRYSTYFIHFQELIAQLKKALLENRLEYRLKHFSKYKVLIIDEIGYLPIDNDGA
NLFFQLISSRYEKSSTIITTNVVFSEWGEIFGGATIANAILDRLLHHSYVIFIKGPSYRL
QSKTVYFSNTNQQN
Download sequence
Identical sequences H9UCD3
WP_014451263.1.64957 gi|383786360|ref|YP_005470929.1| gi|383786401|ref|YP_005470970.1| gi|383786726|ref|YP_005471295.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]