SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000000565 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000000565
Domain Number 1 Region: 219-344
Classification Level Classification E-value
Superfamily TIMP-like 9.42e-25
Family Tissue inhibitor of metalloproteinases, TIMP 0.039
Further Details:      
 
Domain Number 2 Region: 44-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 107-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 4 Region: 3-32
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000000565   Gene: ENSLACG00000000502   Transcript: ENSLACT00000000568
Sequence length 345
Comment pep:known_by_projection scaffold:LatCha1:JH131076.1:2716:34281:1 gene:ENSLACG00000000502 transcript:ENSLACT00000000568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHGRCVCKHNTAGDHCQHCAPLYNDEPWQPANGKTGMPNECKKCKCNEHADRCHFDMGTW
LASGNRSGGVCDNCQHNTEGQNCQRCKPGLYRDPQKPFSAPDVCKPCSCHPTGSTIFNIN
TYPYFLCDPSNGDCLCKPGVAGPHCDRCMVGYWGFGQYGCRPCDCAGSCDPLTGDCISRY
IDIFYADWKHSGMAFVTVHNESEPPQGWEDEQGFSAVRHSGKCECKEQILGHPKGFCGMK
YAYVLKAKILSAHDRGSYAEVNIKVKKVLKMTKLKVFRGKRKLYPESWTNRGCTCPILNP
GMEYLVAGHENVRTGRLIVNMKSFVKPWKPDLGRKVMQILKTYCH
Download sequence
Identical sequences H2ZT44
ENSLACP00000000565 ENSLACP00000000565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]