SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000000740 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000000740
Domain Number 1 Region: 197-392
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000025
Family Hermes transposase-like 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000000740
Domain Number - Region: 17-52
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0816
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000000740   Gene: ENSLACG00000000664   Transcript: ENSLACT00000000746
Sequence length 550
Comment pep:novel scaffold:LatCha1:AFYH01276971.1:3947:5627:1 gene:ENSLACG00000000664 transcript:ENSLACT00000000746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKNGPMQPKLSQYPQQKFRLKKRSFQYHWFEKHNWLEYSKKNAAFCFACRYLGLKNTKDS
LLSNGFNNWKRALDSFREHEKAAVHKGSMLAWAAFRNSEVHGDVVQQLQAANENEIKERR
EYVRRIVTLRVCLSLLRKQGISFRGHDETEHSQNKVNFMECFNLLTKFDPFLQKITKRHL
INEVILCCSEQVTFSIVSELKTSGIYAIMADEARDKHKEQLALCVRYVVTATGSVKEHFL
GFCDLKSFSAESITESIQHCLRDNGLEDLQCVAQIYDGASVMSGATGGVQAKFQQYHPEA
IYVHCYAHQLNLVLCHMCKAATDFFNTLENLYTFFSASLIHHKKFSDVQAQLGLKHSELV
QLSDTLWSCQLRSVNALLTNFTAVIQCLSEIQSTTATGLLTKLCDLPMVCCLFMFHFLLG
TTEGFHKVLQKENLDLAQAVDLKEAVYSALKNMRTNEMAKALYDKAKTFCTNNNIDIWEV
EPTVRRKKQKRMDDFLVESTCDIREEISGLDNFRMKLFYPSLDRILSEIGQRFSSVNADL
MKGVQACNPS
Download sequence
Identical sequences H2ZTL9
ENSLACP00000000740 ENSLACP00000000740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]