SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000000884 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000000884
Domain Number 1 Region: 95-160
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.79e-20
Family SAM (sterile alpha motif) domain 0.00057
Further Details:      
 
Domain Number 2 Region: 14-81
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000109
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000000884   Gene: ENSLACG00000000796   Transcript: ENSLACT00000000893
Sequence length 161
Comment pep:novel scaffold:LatCha1:JH126723.1:5248:18843:1 gene:ENSLACG00000000796 transcript:ENSLACT00000000893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKCRIRPYKLMGGKSQVILSIEEGYRLPAPMGCPTTLHQLMLHCWQKERNHRPKFTDIVS
FLDKLIRNPSCLQNLVEDIHGVPCPVLSRPREVPEFPLFVSVSDWLDSIKMGQYMNNFMA
AGLTTMDMVTRMSIDDVRRIGVVLIGHQRRIVSSIQTLRLQ
Download sequence
Identical sequences H2ZU13
ENSLACP00000000884 ENSLACP00000000884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]