SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001176 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000001176
Domain Number - Region: 130-153
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0471
Family Pentapeptide repeats 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001176   Gene: ENSLACG00000001053   Transcript: ENSLACT00000001187
Sequence length 401
Comment pep:novel scaffold:LatCha1:JH130713.1:9223:10425:-1 gene:ENSLACG00000001053 transcript:ENSLACT00000001187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPLGMEFVTILMENRSNNNTSGNRSSITISALYTSTYVSVFIFNTSFHEHFILAANKTVL
VSIENPAELGSNSKTVIIRANSSIAVMSFTLNPDSTEPTIVYPVTYFGTEYYILTPKSRH
QQSFTKFTVINFGYMNLINVNISGSIFYNCTFYPAGSKLTFTLLEYETIQIESDEDLTGS
HIVSQYPVAVLSKTAATCFAGNTQVFEQLSPVCKWGTSFIVLPFSDQNSSDLVYVVASQD
TNLQVQAGLTPKIISLSGGETKELSLENSAPLVINATAGIMVMLYHERKTNSTLTKSTLM
NVIPTEKFSSSYISISYPNFESHIVLITNSSETSGVMVDKKTLSPNKTWRAIPGTEFSWT
NFNITFGNGFHMVTHSSSLLGVYEYGIASFHSWSSTETCLD
Download sequence
Identical sequences H2ZUV5
ENSLACP00000001176 ENSLACP00000001176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]