SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001402 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001402
Domain Number 1 Region: 312-553
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000494
Family Rhodopsin-like 0.024
Further Details:      
 
Domain Number 2 Region: 4-50
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000706
Family Hormone receptor domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001402   Gene: ENSLACG00000001257   Transcript: ENSLACT00000001414
Sequence length 569
Comment pep:novel scaffold:LatCha1:JH127032.1:13456:25594:1 gene:ENSLACG00000001257 transcript:ENSLACT00000001414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFCDGGPHWNKTKAGRTAKLPCPSGRVGNKWRRCSFYGKWGNVTENCTSAILNDLFKNIM
VFTSFYLYYEKKLLFNLSDPIQMEAKTASDLELSMKILGIMANISFHQNATINAIVFSNI
LAVASNITNRSLLPSYSTSNEEKSTFSTLLQAVETFSLLLQPDNETFEVFYPNVQMKGMK
FSVRSRRNNEQKIDMTPYLAVCIDMSNIFKFPENVNVIIITVTYASLPEVSPIFPDKFQD
YFVNSLIHSTSVRVNNMEYKEVNIQMVFELRNTSVNLESAACVYWDFSLRRGRGGWAEDG
CNAKTDGNITTCHCSHLTSFAVLMSRSPPQEPEYIYLVTYLGLGVSIGSLCICIFIEVLV
WKSVVKSNLSHFRHVALLNIAVSLLIADICFVCASSNFVLKVAHACTALTFLNHFFYMAL
FFWSLCQSIILLHKMVFPFSLLRKKTYLRVSFLIGYFFPLGIAAATLLYFYPKGKYQNKI
ACWLDQSGAMYAFVVPVGCIIVTNLITLIVVIAKLMRPSISDGGHVEEKDVAKRMVKALL
ILIPTFGVTWALGYLLIGRFPQEVLVIFK
Download sequence
Identical sequences H2ZVI1
ENSLACP00000001402 ENSLACP00000001402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]