SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001666 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001666
Domain Number 1 Region: 797-865
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000636
Family IBR domain 0.00014
Further Details:      
 
Domain Number 2 Region: 68-144
Classification Level Classification E-value
Superfamily PUG domain-like 0.00000000000183
Family PUG domain 0.0039
Further Details:      
 
Domain Number 3 Region: 714-777
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000053
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 4 Region: 406-429
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000549
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 
Domain Number 5 Region: 878-948
Classification Level Classification E-value
Superfamily RING/U-box 0.00000836
Family RING finger domain, C3HC4 0.029
Further Details:      
 
Domain Number 6 Region: 347-373
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000286
Family Ran binding protein zinc finger-like 0.0033
Further Details:      
 
Domain Number 7 Region: 594-630
Classification Level Classification E-value
Superfamily UBA-like 0.0000511
Family UBA domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000001666
Domain Number - Region: 304-329
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00314
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 
Domain Number - Region: 212-243
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00649
Family TFIIH p44 subunit cysteine-rich domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001666   Gene: ENSLACG00000001490   Transcript: ENSLACT00000001679
Sequence length 1087
Comment pep:novel scaffold:LatCha1:JH128757.1:20309:69634:1 gene:ENSLACG00000001490 transcript:ENSLACT00000001679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDGKKEEYFLELRQEAVGKVAEFPGEPPRELLGKMAAAQLPLKEKYCELDAAHIIKVNFK
GTLLQNLRVISTAFNILEKYGCNLLNPFKPKYWRSVKFNNPVFKSTVDAIMGGRNVLQLY
GYSEEQTDGLAFPEDVAEPDISRVASVTVDVMLLRMELDQLLKGTHVHPEIFYPVIPREV
LHPASVQLASLPPVQSMMSPVSVTTPGLSSMTLCALCGEASVSTHCPSCVYMLCAECDVR
YHKHPARSTHVRLPVQRAPQTRVSSQNLDIHLAPSTGQSLKSFWRGLSAEPLEFKQQQSP
LPRPPWHCVGCYTLNEARSVLCVACDRPRGCKSAPSLEQEDKSLSSRGRWSCQACTFENE
SAAVLCSVCERPRLAGKPPVKVDDERLSGLQFQNAATVQPSFQQALGWECEHCTYFNTKP
GRICEMCDRTSTVATGQLLTRVPTTLVDRVSTLEQKLKRGLEQSSQPTSGVPGQAKMNSK
ADTRNQDEDWLWQEQMRARGQKLVQMIREGEKNGVSPEDVYCAVRYSGTEVPVQWLRTEL
PHVLETIADLATQKGAAMVENTVGVVRLEEARLAWRACEGNIEDAVQECVTMRRRKFQEL
KVMGFSDREEVLQSLYINGGDVSKALTDLQRKLLEPFHQHIWEELDPPIRIDRTDRQRLL
RQILAVYNLPSWGRAELVLSLAQEREGNYDLHDVVEAVKQSHDKHFIKRMLSQECAVCFY
SFPRNRMQSLTSCECTICPDCFKQYFTITVKEKNIKDLVCPQCSKPEISDEGELLNYFST
LDIQLRDCLDKDAYDLFHKKLTERTLMNDPKFVWCSHCSFGFIYDGDQLKVTCLQCKKSF
CIKCKRPWEVQHQGITCEEFQNWKRENDPEYQAQGLAAYLKENGIICPHCKFAYALARGG
CMHFNCSQCRHEFCSGCYNTFAKNDCTFKNCTMGKTLHAHHPRDCLFYLRDWDVARLQVL
LKKDGVNFNMEPPHGTQAAPGGGCRVLEQKELPSGVKDEPCAKVTPAGYAGLCISHYKEY
LVSLINDHMLDPAPLYDLKELETVCQRYRLGLAPQAQGEDEAAYLGRLLAKLTTEVPLGD
KIPRKRK
Download sequence
Identical sequences H2ZW95
ENSLACP00000001666 ENSLACP00000001666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]