SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001769 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001769
Domain Number 1 Region: 18-266
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000449
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001769   Gene: ENSLACG00000001580   Transcript: ENSLACT00000001782
Sequence length 278
Comment pep:novel scaffold:LatCha1:JH130784.1:15675:24086:1 gene:ENSLACG00000001580 transcript:ENSLACT00000001782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQSTQRKRFGHQKSQGNLFIVIVNYQKFWRTRTLQPSEQIVSCIAVSNILVVIVLAVW
FTGFLLGVCTYLGAHVYQVTDFLVILFSKSGHWFTAWLCFFYCVKIIKVNWRIFMKLKQS
ISSLVSFLLIATVLCNFGVAYPVTYIIRSLNTTNSNEECKDYHIFGHEYLVGYAVFLSVI
TSLLPLVLMLISSLGIVVFLLKHSKNMSKTSNTTSGSRSEGPTAVAKMLVSLIILYMVSV
ISALVTNHVATVIQSSMVVIIASSVCIFSAGSSVILIV
Download sequence
Identical sequences H2ZWJ8
ENSLACP00000001769 ENSLACP00000001769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]