SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001910 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001910
Domain Number 1 Region: 37-239
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-39
Family Pentraxin (pentaxin) 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001910   Gene: ENSLACG00000001707   Transcript: ENSLACT00000001923
Sequence length 245
Comment pep:novel scaffold:LatCha1:JH126681.1:26242:44923:-1 gene:ENSLACG00000001707 transcript:ENSLACT00000001923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSTLRGLNITELIKQASDMKSIIFLLFFIKGLHGLTGLEGKVVSFPTETATSYVELTPQ
HEEELEAFTICLRFNTSLTRSYSLFSFATSAYYNDILLWSNNQRRYSIYVHNSYVSFTIP
NGRSTTGWPHFCGTWESDTGKAELWLNGKSLGTKTLRRGSTVKSNPSIIIGQEQDSFGGS
FQQSQSFVGNITDVHMWDYVISSCKIKSARYGSSCAKGNLIDWDTVTFHKSGNVITEPKV
EEDYY
Download sequence
Identical sequences H2ZWY9
ENSLACP00000001910 ENSLACP00000001910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]