SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001927 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001927
Domain Number 1 Region: 44-82
Classification Level Classification E-value
Superfamily WW domain 0.00000000636
Family WW domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001927   Gene: ENSLACG00000001721   Transcript: ENSLACT00000001941
Sequence length 203
Comment pep:known_by_projection scaffold:LatCha1:JH130952.1:28218:42830:1 gene:ENSLACG00000001721 transcript:ENSLACT00000001941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPLALQARLAKRGILKHVEPEPEEEIIAEDYDDDSVDYEATRAENLPPNWYKVFDQGC
GLPYYWNVETDNVSWLSPNDPAAIITKAVKKFKDPEDRPERMFEKVEREEVRDRRHQRRE
EIAPYSKGKKGREKRDEELDPMDPSAYSDAPRGSWSTGLPKRNEAKTGADTTAAGPLFQQ
RPYPSPGAVLRANAEATRAKQQE
Download sequence
Identical sequences H2ZX06
XP_006013591.1.90931 XP_006013592.1.90931 XP_006013593.1.90931 ENSLACP00000001927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]