SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000002183 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000002183
Domain Number 1 Region: 607-750
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.13e-30
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0006
Further Details:      
 
Domain Number 2 Region: 3-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.07e-28
Family PARP-type zinc finger 0.00000547
Further Details:      
 
Domain Number 3 Region: 499-597
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.76e-25
Family ATP-dependent DNA ligase catalytic domain 0.0028
Further Details:      
 
Domain Number 4 Region: 879-959
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000916
Family DNA ligase 0.00024
Further Details:      
 
Domain Number 5 Region: 172-351
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000000366
Family ATP-dependent DNA ligase DNA-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000002183   Gene: ENSLACG00000001951   Transcript: ENSLACT00000002200
Sequence length 960
Comment pep:known_by_projection scaffold:LatCha1:JH128177.1:35740:258213:1 gene:ENSLACG00000001951 transcript:ENSLACT00000002200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMAEQRYCVDYAKRGTAGCKKCKDKIAKGMVRIAKVVPNPFTESGGDMKEWYHVKCMFEK
LERARATTKKIEDLTELEGWQELQDAERDLINQHITELANKTATTPKKKVTVQAKLSPAG
QVISSSKLPTAGPSSAPRKFPGFTELATKAESTDDAPSTDGPSAQSCDLSHKDCSLREFR
KLCANIADKPSYNVKTQIIQDFLYKGAGGDGFHGDTYLTVKLLLPGVIKSVYNLNDKQIV
KIFSKIFNCNLEEMVQDLEQGDVSETVRIFFEASCTFLAAAKSTLSIQEVDAFLQHLSKL
TKEDDQQRLLQDMASRCTANDLKCIIRLIKHDLKMNAGAKHVIFVLCNLQYDILRKKKRK
TPFKKIIPPPARRELSLEKGEGKGEAKNLKASLLQQNNSFKPRLSWFVKHLTWILVISLR
GMYIALKSFSIESFSISKQSKNKSYKAIEMKYLNPSQQKHLKRQISQTLVLQYSKILCKS
TLSISGSFSKLYPSAPLSQQKAAFQDANVCLFVFDCIYFNGVSLMDRPLIERRKFLHDNM
VEIPHRILFSEMKHVTKASDLADMITRVIREGLEGLVLKDTKSLYEPGKRHWLKVKKDYL
NEGAMADSADLMVLGAFYGQGSKGGMMSIFLMGCYDPSCGKWCTVTKCAGGHDDATLARL
QNELDMVKISKEGSRIGEWSEINRTYVREAIIPETKKAPIWEITGAEFSKAEAHTANGIS
IRFPRCTRIRDDKDWQTATNLQQLQELYRVSKETLDTNLLTSLSKGTDDSSGGSNGDTED
SSKPSTPGISKPSSSRGSSKGSTAKSPGKEQKKPKSQQGTSSSAWKSPTEEGVDPTAGKG
VKRKLITPEQNGKKMKLSGPVSSGEKTKSSSLSAQSIASSQHKTLLDIFTGVRLYLPPSV
EDFSKLQRYFIAYDGDLVPEFDTSGATHTVSDLEGNSNAKRVSPNWIWECVKKRRVVPPC
Download sequence
Identical sequences H2ZXR2
ENSLACP00000002183 ENSLACP00000002183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]