SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003162 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003162
Domain Number 1 Region: 242-552
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.47e-91
Family Protein kinases, catalytic subunit 0.0000000182
Further Details:      
 
Domain Number 2 Region: 61-187
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.99e-36
Family Synaptotagmin-like (S variant) 0.00000343
Further Details:      
 
Domain Number 3 Region: 5-58
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.34e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003162   Gene: ENSLACG00000002827   Transcript: ENSLACT00000003192
Sequence length 578
Comment pep:known_by_projection scaffold:LatCha1:JH126782.1:60613:326194:-1 gene:ENSLACG00000002827 transcript:ENSLACT00000003192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPRSRHMFKIHSYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHT
ERRGRIYIKAHINNETLVVVVKEARNLVPMDPNGLSDPYVKLKLIPDPKGESKQKTKTIK
CSLNPDWNETFKFSLLKESDKDRRLSVEIWDWDLTSRNDFMGALSFGISELQKAGVDGWF
KLLSQEEGEYFNVPVPPEGEEGNEELRKKFERAKIGPGSKATEDKVKNSSSKFGNNGNRD
RIKLSDFNFLMVLGKGSFGKVLLVERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLA
LSGKPPFLTHLHSCFQTMERLYFVMEYISGGDLMYQIQQAGKFKEPHAVFYAAEIAIGLF
YLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAY
QPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGL
MTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLEQKEIQPPFKPKTCGRKAENFDRFFTR
HPPVLTPPDQEVIMNIDQSEFEGFSFVNHEFIKPEVKS
Download sequence
Identical sequences H3A0J1
ENSLACP00000003162 ENSLACP00000003162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]