SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003163 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003163
Domain Number 1 Region: 255-394
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-40
Family Protein kinases, catalytic subunit 0.00000601
Further Details:      
 
Domain Number 2 Region: 79-204
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.85e-36
Family Synaptotagmin-like (S variant) 0.00000304
Further Details:      
 
Domain Number 3 Region: 16-76
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.14e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003163   Gene: ENSLACG00000002827   Transcript: ENSLACT00000003193
Sequence length 394
Comment pep:known_by_projection scaffold:LatCha1:JH126782.1:122728:389586:-1 gene:ENSLACG00000002827 transcript:ENSLACT00000003193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HEFVTFSCPGADKGPASDDPRSRHMFKIHSYSSPTFCDHCGSLLYGLIHQGMKCDTCMMN
VHKRCVMNVPSLCGTDHTERRGRIYIKAHINNETLVVVVKEARNLVPMDPNGLSDPYVKL
KLIPDPKGESKQKTKTIKCSLNPDWNETFKFLLKESDKDRRLSVEIWDWDLTSRNDFMGA
LSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRKKFERAKIGPGSKATE
DKVKNSSSKFGNNGNRDRIKLSDFNFLMVLGKGSFGKVLLVERKGTDELYAVKILKKDVV
IQDDDVECTMVEKRVLALSGKPPFLTHLHSCFQTMERLYFVMEYISGGDLMYQIQQAGKF
KEPHAVFYAAEIAIGLFYLHSKGIVYRDLKLDNV
Download sequence
Identical sequences H3A0J2
ENSLACP00000003163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]