SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003482 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000003482
Domain Number - Region: 16-49
Classification Level Classification E-value
Superfamily TIMP-like 0.0942
Family The laminin-binding domain of agrin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003482   Gene: ENSLACG00000003106   Transcript: ENSLACT00000003513
Sequence length 139
Comment pep:novel scaffold:LatCha1:JH130435.1:70783:71316:1 gene:ENSLACG00000003106 transcript:ENSLACT00000003513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYSSPSVGSVQELALRSRVVIEGKVQELFPNITSISESYLVKVRVYQVWAVKAGGLEKDS
LISVVGEFDLSCLKLKKDSRYIFFLEPTNITFVFMASFPPLETGRNIKKDVSRILCQGCG
KFAKKISPTLMVVLDPSAL
Download sequence
Identical sequences H3A1G1
ENSLACP00000003482 ENSLACP00000003482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]