SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003592 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003592
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-38
Family RUN domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003592   Gene: ENSLACG00000003199   Transcript: ENSLACT00000003624
Sequence length 1123
Comment pep:known_by_projection scaffold:LatCha1:JH128310.1:74029:95818:1 gene:ENSLACG00000003199 transcript:ENSLACT00000003624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDGEVYFQRVVKDLQSIILELQEEHREKSSPINDGSPALHRLCAKLEYLLQFDQKEKK
SFFGNRRDYWDYICCCIGKKKGGNDGVHFVSSIPELKTSLGKGRAFIRCCLVQKQLAESL
QLCTVDPNITSDWYYARSPLLNKELTSTIISHLYELNGINFKLALTGVDLDSAWPTFAGP
LLDSITGSFPWSTSPSDACTCTLCCQFQQSITFHPGNTSQLAHLCCINFNPLLASFLCYR
MTLPKLFGEQKRVTFRIQDQSDKYNQKWSSFLACAGGVIYVYNSCCYIGIESYLGLVLLV
SLKEKTVFCDSSNRNCKVSLLLNCIEDQNKELINKMDSVLREMSQVRASHVSEDLNKVHE
LLDSLEASEKREIELQQQNVECQTQIGKQEHAHLEKMTSLEQELEKTKEAHKQQTETIMQ
LEESNNILNETTEELDCLISDLKEKVSGKDQENVLLISNHQEEVTALNKAHAEEVEKLKS
KLSDTVDQYEKQQNNIERQLTEALELLDVKEQALGEIKGKLQSAEMSRKNLEKVQEQLKK
NCSMQEESKSEVSKLKVCEKELLEQTLNSSLTLDEKEQKLRTENQTLEEQLRDAQIQNET
LNQKLKKSFLQKEDLEKEKDTLSESLATLEQSLKNAKLETQKLNKQLIFQQKEISDLKNS
ITLEEDNLKEKQHELKLLEQKLAKTASQLEETKLQKIDLEGKLADNTAHMEELTNSRAIV
ETQVTEELRSKLSLCEKQLYQKELEVAKFEEEGLKLKAALQKASEEKGSKLKSVAVTLEE
KAQEIAKLRNEAEELKKLNEEEIAKLKEKILATQGERDTLTQQKTELENKNFEMNKEYVQ
LKYQVKKLEMENSKAKEVLDKTKSESDQASIQLSCLSVEKEGLGKKLAGTEAELSQQKEK
TSKAEQELQSTLDRLQQDQLSLQEVTAAMEDLKRVNQELLVRLQTTEGQLTALDTVKKQE
IIKLKEEFAEEVEDHEAKIKVKKTLSIKSNVDSPSQEHTVYTEKTMVIDISFGTIRKAFK
VLNEDLLKVKQENQLKEESLTDKENEMKSHMEELEKAKRDYEGLKEKLEKTQAEARDKER
KYKTEIEDQKHMIRTMKDRVLELLNREKDALWQKSEQLRFEQR
Download sequence
Identical sequences H3A1S1
ENSLACP00000003592 ENSLACP00000003592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]