SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003688 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003688
Domain Number 1 Region: 211-457
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.18e-48
Family ATP-dependent DNA ligase catalytic domain 0.00045
Further Details:      
 
Domain Number 2 Region: 464-609
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.26e-31
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00043
Further Details:      
 
Domain Number 3 Region: 627-750
Classification Level Classification E-value
Superfamily BRCT domain 5.1e-19
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 4 Region: 803-911
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000183
Family DNA topoisomerase II binding protein 1, TopBP1 0.037
Further Details:      
 
Domain Number 5 Region: 14-236
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.00000000000719
Family ATP-dependent DNA ligase DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003688   Gene: ENSLACG00000003282   Transcript: ENSLACT00000003721
Sequence length 911
Comment pep:known_by_projection scaffold:LatCha1:JH126913.1:77097:79832:-1 gene:ENSLACG00000003282 transcript:ENSLACT00000003721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEASTDSLPKKTVASQVPFADLCSTLEKIQKSKLRQDKTKYFGDFLDSWRKFHNALHK
NDLGTTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIDVLGLPKEGKDALKLLNYRTP
TSTQNEAGDFAVIAYFVLKQRCPNQGILTIQQVNCLLDSIANNNAVKGKDLMKKSLQQLI
TQSSALEQKWLIRMILKDMKLGISQQTIFHLFHPDAAELHNVTTDLDKVCRQLHDPSVSL
SDVSIMMFSAFKPMLAAIANIKQIEKQMNNQSFYIQMKLDGERMQLHKDGDVYKYFSRNG
FDYTQQFGAAPLDGSLTPFIHNVFKDTVQNCILDGEMMAYNPNTQTFMQKGSKFDIKRMV
EDSELQTCYCVFDVLMVNDQKLAQETLRRRHEILQTVFTPTQGRIHIVQKIEARTKKEVV
DALNDAIDNREEGIMVKDPMSVYKPDKRGEGWLKIKPEYVDGLMDELDILIVGGYWGKGL
RSGMMSHFLCAIAETPPSGKKPSVFHSFCRIGSGYTMEELYNLGLKLAKYWKPYSKKNPP
PTLLCGTEKPEFYLEPSNSVIVQVKAAEIVTSDMYKTGCTLRFPRIEKIREDKDWYECMT
LNDLDQLRDKASGKLASKHVDVDDVEPGKKRKIMPKVKKVIGIMEQFKAQDLSNVSKVSN
IFEDVEFCVINGNNEHSKTELEKGIAECGGLVVQNPGPETYCAIAGTENVRVKNITSSNK
HDVVKVEWLLDCLKKREFVPWQPCHMIHMSPSTEQHFACEYDRYGDSFYADTAEHQLKEV
FLRISKTKLKVRLDTIAELEQRYSWDESPLRMFREYVVYVDLYYIISDTAAKIQGTGLDI
RVLELRFHGAKVVTQLDECVSHVIVSDDHSRVSELKALRRTFKKKFKIVSDLWVIDSVKT
GCVQDENTYLI
Download sequence
Identical sequences H3A217
XP_005997060.1.90931 XP_005997061.1.90931 ENSLACP00000003688 ENSLACP00000003688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]