SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003793 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003793
Domain Number 1 Region: 128-221
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-28
Family Pleckstrin-homology domain (PH domain) 0.0000146
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-23
Family SH2 domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003793   Gene: ENSLACG00000003380   Transcript: ENSLACT00000003827
Sequence length 245
Comment pep:known_by_projection scaffold:LatCha1:JH129095.1:81131:103481:1 gene:ENSLACG00000003380 transcript:ENSLACT00000003827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WYHHNLSRHAAEALLLSNGTDGSFLLRKSKENENLFSLSVRAKDSVKHFHVERINSSYKF
GFNEFSSLKEFANHFANQPLIGSETGTLIVLKSPYPRAVEEPSIYESVRVHTAMQIGKTK
DDLVLNAPSLGTKEGYLTKQGALVKNWKTRWFTLQRNELKYFKDKWSTEPIRTLDLTECT
AVQFDYSQEKINCFCLVFPERTFYMCAKTGIEADEWIKILRWKLIKVRSHLGLHYTCPSK
PFLGG
Download sequence
Identical sequences H3A2C2
ENSLACP00000003793 ENSLACP00000003793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]