SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003911 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003911
Domain Number 1 Region: 525-770
Classification Level Classification E-value
Superfamily vWA-like 3e-72
Family Trunk domain of Sec23/24 0.0000757
Further Details:      
 
Domain Number 2 Region: 773-868
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.44e-35
Family beta-sandwich domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 3 Region: 975-1116
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.94e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.00077
Further Details:      
 
Domain Number 4 Region: 870-974
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.71e-30
Family Helical domain of Sec23/24 0.0074
Further Details:      
 
Domain Number 5 Region: 437-521
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 2.88e-25
Family Zn-finger domain of Sec23/24 0.00068
Further Details:      
 
Domain Number 6 Region: 292-540
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.18e-23
Family beta-sandwich domain of Sec23/24 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003911   Gene: ENSLACG00000003484   Transcript: ENSLACT00000003946
Sequence length 1120
Comment pep:known_by_projection scaffold:LatCha1:JH127674.1:81270:156251:-1 gene:ENSLACG00000003484 transcript:ENSLACT00000003946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVNQQAHMASYGQPQHAYQQHGYGGQIIPNVPVSQYGPYNGPALGPPQGPLRASHSTGA
PSPAPRPQAVYSQYGQGDMQNGPAPIPNQMHRPPVSQPYMPGTAPLPASQPPPYQQFTLP
PTSAHQLTNQMAGMQLSGAQTSTAPPVTGPGYGSQTTQQPTSGNFPSTGPAPYVPYSASS
SHFPANNLPGPPPTSLSQGSSLTQPPFSGPPPQRFSAPPTSTFMTPQTTSYVPSNFPPPA
GASRPPTMQGPPLPGQQFTGPPVSQPNHISGTSLQQGMSGVPPGPPGAVLQGLPPPPQAG
QQGFPPQQNGSFGQIRGPQPNYGGGFTGAANYGGQVPPPTAPPQKRLDPDSIPSPVQVIE
DDKASRGSEPFTTGVRGQAPPLITTNFLVKDQGNASPRYIRCTAYNFPCTSDMAKQSQVP
LAAVIKPMAALPLDEVPPYIVDHGESGPIRCNRCKAYMCPFMQFIEGGRRFQCAFCSCVT
EVPPHYFQHLDHTGKRVDYYERPELSLGSYEFLATVDYCKNNKLPNPPAFIFMIDVSYNA
VKSGLVNLICDELKTLLDYLPREGSVEESAIKVGFVTYNKVLHFYNVKSSLAQPQMLVVS
DVADMFVPLLDGFLVNNNESRTVINSLLEQIPEMFADTRETETVFGPVIQAGLEALKAAD
CAGKLFIFHSSLPIAEAPGKLKNRDDKKLINTDKEKTLFQPQTSFYNNLSKECVAQGCCV
DLFLFPNQYVDVATLGVVPFQTGGSLYKYTYFQVATDGERFLKDLHRDVQKVVGFDTVMR
VRTSTGIRATDFFGTFYMSNTTDIELAGLDSEKTITVEFKHDDKLSEDSGALMQCALLYT
SCGGQRRLRIHNLALNCCTQLADLYRNCETDTLINYFAKFAYRGVLSNATKAVRESLINQ
CAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDMLQAGADVSTDDRAYIRQL
VTAMDVAETNVFFYPRLLPLHKLDVDSDALPVAVRDSEERLSKGGIYLLENGLNIFLWVG
MNVQQELIQSIFNVPSFGQIDCSMNAMPVLDNPFSKKIRAMIDAFRAQRPRFMKFLIVKQ
EDKLELLFKHFLVEDKNMNGGASYVDFLCHMHKEIRQLLS
Download sequence
Identical sequences H3A2P0
ENSLACP00000003911 ENSLACP00000003911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]