SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004019 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000004019
Domain Number - Region: 439-499
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000955
Family Hormone receptor domain 0.0034
Further Details:      
 
Domain Number - Region: 167-283,329-357
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0131
Family YVTN repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004019   Gene: ENSLACG00000003578   Transcript: ENSLACT00000004055
Sequence length 1437
Comment pep:known_by_projection scaffold:LatCha1:JH127484.1:89708:240172:-1 gene:ENSLACG00000003578 transcript:ENSLACT00000004055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFSRSALPFGLVRRELSCEGYPIDLRCPGSDVIMIESANYGRTDDKICDADPIKREKTPC
NLPKRFLIYTQMCNNRTQCIVITGSDVFPDPCPGTYKYLEVQYECVPYIFVCPGTLKAVV
DSPYIFEAEQQAGAWCKDPLQAADKIYFMPWTPYRTDTLIEYASLEDFKNGRQTTTYKLP
NRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKSGEAIINNANYHDTSPYRWGGKTDI
DLAVDENGLWVIYATEQNNGMMVISQLNPYTLRFEATWETTYDKRSASNAFMICGVLYVV
RSVYEDNESEMGKNAINYIYNTKITKGEYVDIPFPNQYQYIAAVDYNPRDNQLYVWNNYF
TLRYSLEFGPPDPAQVPTIVVTTLSPAEISKTTLATTTTTSQKGLLTTTSAGGMREGSRG
PKPSPVIPVTRIPPVTSFFPLPERFCDPTEARGINWPQTQRGVVVEWPCPKGTRGTASYL
CMVSTGMWNPKGPDLSNCTSHWVNQVAQKIRNGENAANLANELDRHTKGPIFAGDVSSSV
RLMEQLVDILDAQLQELRPSEKDSAGRSFNKAIVGTVDNLLRPEALESWKDMNSTEQTHA
ATMLLDTLEEGAFVLADNLIEPARVTVPAENIVLEVAVLSTEGQVQHFRFPQGNKGGNSI
QLTANTVKQNSRNGLAKLVFILYKSLGQFLSTENATIKLGNDVSIGNSTIAVNSHVIAAS
INKESSRVYLTDPVHFTLKHIDPNNYFNANCSFWNYSERIMMGYWSTQGCKLIDTNKTHT
TCACSHLTNFAILMAHREVMYKDRVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQS
DRNTIHKNLCINLFIAEFIFLIGIDKTNYEIVCPIVAGLLHFFFLAAFSWMCLEGVQLYL
MLVEVFESEYSRKKYYYVSGYLFPATVVGVSAAIDYKSYGTEKACWLTVDNNFIWSFIGP
VTFIIMLNLLFLVITMYKMVKNSTTLKPDSSRLENINNYRVCDGYYNTDLPGSWVLGAFA
LLCLLGLTWSFGLLFVNEESVVMAYLFTIFNAFQGMFIFIFHCALQKKVRKEYSKCFRHS
HCCGGLPSESSHSSVKASTTRTSTRYSSGTQSRIRRMWNDTVRKQSESSFISGDINSTST
LNQGMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSGPVFNSPGHSLNNARDTSAMD
TLPLNGNFNNSYSLRNGDYNDSVQVVDCGLSLNDTAFEKMIISELVHNNLRGSSKNHNIE
RALPTKVVIGGSSSEDDAIVADASSLVHCDNPGLELHHKELEAPLIPQRTHSLLYHPQKK
VKTEATDSYVSQLTTEAEDHLQSPNRDSLYTSMPNLRDSPYPESSPDVEEDLSPSRKSES
EDIYYKSMPNLGAGHQLQMYYQISKGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL
Download sequence
Identical sequences H3A2Z8
ENSLACP00000004019 ENSLACP00000004019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]