SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004140 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004140
Domain Number 1 Region: 95-192
Classification Level Classification E-value
Superfamily TAFH domain-like 3.53e-23
Family TAFH domain-like 0.0000206
Further Details:      
 
Domain Number 2 Region: 486-527
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000384
Family MYND zinc finger 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000004140
Domain Number - Region: 264-273
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000194
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 420-494
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0017
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0084
Further Details:      
 
Domain Number - Region: 242-277
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0837
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004140   Gene: ENSLACG00000003682   Transcript: ENSLACT00000004176
Sequence length 590
Comment pep:known_by_projection scaffold:LatCha1:JH128352.1:92208:143727:-1 gene:ENSLACG00000003682 transcript:ENSLACT00000004176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STERTIRTMPDSPAEGKTQSRATPPSMPPPPPAVTQGATRNPSFTPVTSYGLDRRNWTSP
STLEVWFSFGGGVFSVAKADRKCDPPTCAEFKIVKRKIFLNFLYRIATSASPSVSEAHFF
FPEMHQNSTLTIEDFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLYCARLAKQTPAQY
LAQHEQLLLDANTTSPIDSSEIMLEVNENGKRQTPDRTKENGLDREPLHPDQVSKRPCTM
SPAQRYSPNNGLNPQPNGLPHPTPPPPPPPPPPQHYRLEDMALAHHFREPYRHTDPRELR
ERHRQAAAHAARQEEIIDHRLTDREWAEEWKHLNNLLNCIMDMVEKTRRSLTVLRRCQEA
DRAELNHWIRRYSDAEDMKKGATSTQHPLSNSTTSETPPVEAHRELLPRLPSGYMPEEIW
KKAEEAVNEVKRQAMSELQKAVSDAERKAHDLVTSERAKMERALAEAKRQASEDALTVIN
QQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQSLHTGAPGGHGVS
AGAGTAQADAVANLSSSISSVVTTVGSPSEAGSTAASRSATPAPLETASR
Download sequence
Identical sequences H3A3B9
ENSLACP00000004140 ENSLACP00000004140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]