SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004282 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004282
Domain Number 1 Region: 523-592
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.93e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0003
Further Details:      
 
Domain Number 2 Region: 398-470
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.4e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004282   Gene: ENSLACG00000003810   Transcript: ENSLACT00000004320
Sequence length 892
Comment pep:known_by_projection scaffold:LatCha1:JH126758.1:98670:141370:-1 gene:ENSLACG00000003810 transcript:ENSLACT00000004320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPMRIFVNDDRHVMAKHAAVYPTQEELEAVQNMVSHTERALKAVSDWLDEQEKVPAKEET
ESMETSTDGENKEGEQKTAEQLATAARTLRGVMRVGLVAKGLLLKGDLDLELVLLCRDKP
TISLLKKVAENLAVQFATITEDKYEIIQSIREASIVIKNTKELSLALTIHLTSPVVREEI
EKMAAGAIETVTVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRILRDLCS
RVPTWAPLRGWPLELVCEKSIGTANRPMGAGEALRRVLECIASGILMPDGPGIYDPCEKE
ATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPSNETPIDYTVQ
IPPSTTYAPPSMKRPMEEDGEDKSPNKKKKKIQKKEEKTEPPQAMNALMRLNQLKPGLQY
KLVSQTGPVHAPVFTMSVEVDGKTFEASGPSKKTAKLHVAVKVLQDMGLPTGVEAKAESI
KSEELNEVEEQKPAAPVPAAPPVETTAGTGSSNASQTSEQGPILTKHGKNPVMELNEKRR
GLKYELISETGGSHDKRFVMEVEIDGQKFQGTGSNKKVAKAHAALAALEKLFPNAPPMQE
IKKKKPPLAADMGSRPSSKPHNAGYGMGPVIHNEPLPSPRGRGRGGRGRGRGRGGYSAGN
SAGYMNSVIGYGSYGYGSSATSGYSNYYSNGGYSGGGGGGGGYGSYHQNEGYSAPVPPKH
MGKKQQQQGGGYQKPTYSTVYPTFQQSQYGQSQYGGYGQPTQSKQKSYNQYQQKSYNQYQ
SQGSGGGGSGSGTYSNTPYNYGGEYGGGNSNTSYGSGGSSYNSNTHGGYGGSGSSYQGGG
GGGGGGGGSYSQSNFNTQSNQSYGGTSQGSYQSQGGGGYGRNSDHSMNYQYR
Download sequence
Identical sequences H3A3R1
ENSLACP00000004282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]