SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004308 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004308
Domain Number 1 Region: 37-151
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.88e-29
Family Hormone receptor domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000004308
Domain Number - Region: 110-414
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000128
Family Rhodopsin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004308   Gene: ENSLACG00000003833   Transcript: ENSLACT00000004346
Sequence length 465
Comment pep:known_by_projection scaffold:LatCha1:JH129038.1:98429:198045:-1 gene:ENSLACG00000003833 transcript:ENSLACT00000004346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALIMEKKWAQFLLILSVAEIFVSAVPSESTEASPLGVTRNKIMTAQYECYQKILHKSK
DNKDHHCNRTWDGWLCWDDSPAGKTAIQHCPDYFQDFDPSEKVEKVCDSNGQWFRHPETN
RTWTNYTLCNNKTHEKVKTALNLYYLTIIGHGLSIASLLISLSIFFYFRSLSCQRITLHK
NLFFSFVCNSIITIIWLTAVANNQQLVARNPLSCKVSQFIHLYLMGCNYFWMLCEGIYLH
TLIVVAVFAEKQHLIWYYLLGWGFPLIPVCIHAVARSLYYNDNCWISSDTHLLYIIHGPI
CAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIQFVLVPWRPEG
RLAEEIYDYAMHISMHYQGLLVATIFCFFNGEVQAILKRHWNQYKIQFGHSFSHSDALRS
ASYTASSITEVQGSIYNHECNSEHLNGKSCHDIETVALKSENIYG
Download sequence
Identical sequences H3A3T7
ENSLACP00000004308 ENSLACP00000004308 XP_006010891.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]