SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004339 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004339
Domain Number 1 Region: 134-158
Classification Level Classification E-value
Superfamily WW domain 0.0000144
Family WW domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004339   Gene: ENSLACG00000003858   Transcript: ENSLACT00000004377
Sequence length 159
Comment pep:known_by_projection scaffold:LatCha1:JH127211.1:99038:101643:-1 gene:ENSLACG00000003858 transcript:ENSLACT00000004377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CALKESPQPPPQICAENQFKLCKMNSNPVPPPPGQQVIHVTQDLDTDLEALFNSVMNPKP
SSWRKKILPESFFKEPDSGSHSRQSSTDSGSHPPRLTIQHVRSHSSPASLQLGSGTNATP
SPAQHAHLRQQSYDVTDELPLPPGWEMALTPTGQRYFLK
Download sequence
Identical sequences H3A3W8
ENSLACP00000004339 ENSLACP00000004339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]