SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004443 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004443
Domain Number 1 Region: 156-220
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-21
Family SH3-domain 0.00071
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000004443
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000279
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Domain Number - Region: 222-277
Classification Level Classification E-value
Superfamily SH3-domain 0.00666
Family SH3-domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004443   Gene: ENSLACG00000003952   Transcript: ENSLACT00000004481
Sequence length 279
Comment pep:known_by_projection scaffold:LatCha1:JH130026.1:103045:138419:1 gene:ENSLACG00000003952 transcript:ENSLACT00000004481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTGTNAKHGLRCKACKMSIHHKCTEGVGQQHCMGKLPKGFRRYYSSPLLIHEQFACIKEV
MPIACGSKVDPVYETLRFGTSLAQKTKKTSTGSGSESPHRNSTSDLAEVPEEADGSGSLL
DLRRERSDSVFTSLENGTGNFTREENKKKNLQLKQPPPKDPLQMNTYVALYKFEPQESED
LGMRPGDKITLLDDSNEDWWKGIIEDRVGFFPANFVQRVQTGQRVFKCIRTFIGCKEQEQ
TTLKENQICVGGEEEHNGFMKVYSGKKKGFVPLDVLENI
Download sequence
Identical sequences H3A472
ENSLACP00000004443 ENSLACP00000004443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]