SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004728 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004728
Domain Number 1 Region: 56-187
Classification Level Classification E-value
Superfamily EF-hand 3.89e-46
Family p25-alpha 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004728   Gene: ENSLACG00000004203   Transcript: ENSLACT00000004767
Sequence length 227
Comment pep:known_by_projection scaffold:LatCha1:JH128353.1:113049:171131:1 gene:ENSLACG00000004203 transcript:ENSLACT00000004767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSKAQPTESKAKPPKVASKVAARSPGDHVRERTPRRPPSQSNGTLEGAAAATELSALE
EAFRRFAIHGDTRASGKELHGKNWSKLCRDCNVIDAKSVTITDVDIVFTKVKGKSSRTIT
FDQFQDALRELAKNRFKDKNEEEALQEVYKLIEGKSPIISGVTKTVASPTVSRLTDTSKF
TGSHKERFDQTGKGKGKAGREDLVDASGYVSGYKHAGTYNQKVQGSK
Download sequence
Identical sequences H3A507
ENSLACP00000004728 XP_006008533.1.90931 ENSLACP00000004728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]