SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004999 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004999
Domain Number 1 Region: 227-524
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.46e-89
Family Protein kinases, catalytic subunit 0.0000000217
Further Details:      
 
Domain Number 2 Region: 62-188
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.66e-35
Family Synaptotagmin-like (S variant) 0.00000288
Further Details:      
 
Domain Number 3 Region: 5-58
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.14e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004999   Gene: ENSLACG00000004445   Transcript: ENSLACT00000005043
Sequence length 577
Comment pep:known_by_projection scaffold:LatCha1:JH126741.1:123235:362953:1 gene:ENSLACG00000004445 transcript:ENSLACT00000005043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCETCDMNVHKQCVINVPSLCGTDHT
ERRGRLFLKIEINDEKMYVTVGEAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTRTIR
SSLNPNFNESFTFKLKASDKDRRLSVEAWDWDRTTRNDFMGSLSFGVSELMKQPVCGWYK
LLNQEEGEYYNVPISEADDGNVELRQKFEKAKLGPAGNKVISPVEERKSSTPSNNLDRVK
LTDFNFLMVLGKGSFGKVMLAERKGTEELYAIKILKKDVVIQDDDVECTMIEKRVLALHD
KPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQHVGKFKEQQNRFYAAEIAIGLFFLH
KEGIIYRDLKLDNVMLDAEGHIKIADFGMCKESMYDGATTRTFCGTPDYIAPEIIAYQPY
GKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSMSKEAVSICKGLMTK
HPAKRLGCGPEGERDVKEHAFFRRIDWEKLENREIQPPFKPKGCGKGAENFDKFFTRGQP
VLTPPDQLVIANIDQAEFSGFSFVNPQFLHPCLQSIV
Download sequence
Identical sequences H3A5S8
ENSLACP00000004999 ENSLACP00000004999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]