SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005017 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005017
Domain Number 1 Region: 19-127
Classification Level Classification E-value
Superfamily SRP19 2.09e-38
Family SRP19 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005017   Gene: ENSLACG00000004459   Transcript: ENSLACT00000005061
Sequence length 154
Comment pep:known_by_projection scaffold:LatCha1:JH128202.1:123872:130944:-1 gene:ENSLACG00000004459 transcript:ENSLACT00000005061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEDDSALLGRKMASLSLSPACTERFICIYPAYINSKKTIAEGRRIPVEKAVENPTFAEI
YDVCSAAGLNVVLEKSKLYPREWNRDAQYRGRVRVQLKKEDGSLCLQQFPSRKAVMLYAA
EMIPKLKIRTQKMGGGDPSTQQGEGGKKGKKKKK
Download sequence
Identical sequences H3A5U6
XP_006007938.1.90931 ENSLACP00000005017 ENSLACP00000005017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]