SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005106 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005106
Domain Number 1 Region: 95-176
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 9.1e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005106   Gene: ENSLACG00000004540   Transcript: ENSLACT00000005152
Sequence length 587
Comment pep:known_by_projection scaffold:LatCha1:JH129677.1:124468:203193:-1 gene:ENSLACG00000004540 transcript:ENSLACT00000005152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNNIWLQSSRGPSFAQILKKNIPAQAAAPTVGLAPTYTPSVGCSDSSVGTAKVTQVTG
HFPEPFLSKAVKPTPATALAPKKVPKEFINKYKRGEINPVSALYQFTQMQRMSLDIKETV
TTGNVLGPYFAFCAVVDGIQYSTGLGQNKKEAKANAAKLALEELLQFNDSESEPLKTSGP
PLLPVEPKEPSSALLFTESTPPAKVLCDGRSLVYENVARAVKDMFNSLTRDHSEFQSCGS
SLAAFIVEKAGELCEVVALGTGDFNYSQCICRDGRVVHDSHGVVMARRSLLRFLYRQLLL
YYSKNVNMMEKSIFCIEPTSKVLTIKPNANIHLYLNQLPKGAAQIKSQLRLNPQSFSAYE
ANQELGMHLAVEGKIYPTASCLSAQFASRVNSMSASDKLTRWEVLGVQGALLSHFIQPVY
ISSVLIGDANCTDTRGLEIAVKQRVDDALTSRLPMFYFVNRPHISLVSSVCPVQTDSAPS
TLSLNWSQGDSLLEVVDGHKGKIIESSPFKSGASMASRLCKAAMLSRFNLLAKESNREDL
LTANTYHDAKIMSSSYQEAQCLLKSYLEQNGYGPWIAKSPHSEQFNM
Download sequence
Identical sequences H3A635
ENSLACP00000005106 XP_014353902.1.90931 XP_014353903.1.90931 XP_014353904.1.90931 ENSLACP00000005106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]