SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005115 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005115
Domain Number 1 Region: 30-148
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.2e-39
Family Frizzled cysteine-rich domain 0.000000339
Further Details:      
 
Domain Number 2 Region: 174-288
Classification Level Classification E-value
Superfamily TIMP-like 3.3e-25
Family Tissue inhibitor of metalloproteinases, TIMP 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005115   Gene: ENSLACG00000004548   Transcript: ENSLACT00000005161
Sequence length 318
Comment pep:known_by_projection scaffold:LatCha1:JH127103.1:127141:152602:-1 gene:ENSLACG00000004548 transcript:ENSLACT00000005161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVCMMLCSEVILAFLAVICISTLPRAEGAACEPVRIPMCSPMPWNMTKMPNHLHHSTQAN
AILAIEQFEGLLGTKCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARTGCEPVLI
EYQHSWPESLACEELPVYDRGVCISPEAIVTAEGPDFPMDSFNGNCKGATSERCKCKSVK
PNQKIYLRNNYNYVIRAKVKEVRTKCHDITAVVEVKEILKSSLVNIPRDTVTLYANSGCL
CPPLNATGEYIIMGYEDEQRSRLLLLEGSIAEKWEDRWGKKVKRWDQKLRHPGKGKNEPA
QKDAAQRPGKNNGRQARH
Download sequence
Identical sequences H3A644
ENSLACP00000005115 ENSLACP00000005115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]