SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Latimeria chalumnae 76_1 > ENSLACP00000005302

Domain assignment for ENSLACP00000005302 from Latimeria chalumnae 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSLACP00000005302
Domain Number 1	Region: 54-146
Classification Level	Classification	E-value
Superfamily	PDZ domain-like	6.84e-21
Family	PDZ domain	0.0000526
Further Details:

Domain Number 2	Region: 139-233
Classification Level	Classification	E-value
Superfamily	PDZ domain-like	1.84e-16
Family	PDZ domain	0.0000395
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSLACP00000005302 Gene: ENSLACG00000004711 Transcript: ENSLACT00000005349
Sequence length	242
Comment	pep:known_by_projection scaffold:LatCha1:JH127503.1:135086:149763:-1 gene:ENSLACG00000004711 transcript:ENSLACT00000005349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGLSLNDEEIQKNLSLVPATESAGQLVTRPSAVNCMVAPVSGNDVGIRRAEVKQGLREVI LCKDQDGKIGLRLKSVDNGVFVQLVQRNSPAALAGLRFGDQVLQVNGENCAGWSSDKAHK VLKQAAGERIAFIVRDRPFERTITMHKDSTGHIGFVFKNGKVTSIVKDSSAARNGLLTDH NICEINGQNVIGLKDAQIADILGTTGNIVTITVMPSYICEHMMKRMASSLVKNLMDHTVP EV
Download sequence
Identical sequences	H3A6N1 ENSLACP00000005302 ENSLACP00000005302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]