SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005488 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005488
Domain Number 1 Region: 111-275
Classification Level Classification E-value
Superfamily RUN domain-like 3.27e-47
Family RUN domain 0.000000254
Further Details:      
 
Domain Number 2 Region: 638-703
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000005488
Domain Number - Region: 315-363
Classification Level Classification E-value
Superfamily Prefoldin 0.00471
Family Prefoldin 0.0096
Further Details:      
 
Domain Number - Region: 467-654
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005488   Gene: ENSLACG00000004882   Transcript: ENSLACT00000005536
Sequence length 708
Comment pep:known_by_projection scaffold:LatCha1:JH128201.1:143149:186037:-1 gene:ENSLACG00000004882 transcript:ENSLACT00000005536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASAGDSVGETELLERLGSAGQAEEAREEFEVIDRSHIPSEALSEPAFGPGKDRGAGE
SPRWSAPIFSLARKASESLSVSIAPLSRAAARAGAAGESPEKPGVKDHVIVERSNLMNMM
KLSIKVLIQSALSLGRTLDSDYPPLQQFFVVLEQCLKHGLKVKKSFMGHNKSFFGPLELV
EKLCPEASDLAVSARDLPELRTSVGRGRAWLHLALMQKKLADYLKVLIDRKDLLSEFYEP
GALMMEDDGAVMVGLLVGLHVIDANLCLKGEDLDSQVGVIDFSLYLKDIQSMDSSKHDEE
MTAILDQKHYMEELNRRLSCTVADLQVKMDSLEKTNSKLMEELTAATDRIQSLKEEQQQL
AQENASILKNSERRVEVTKQDTRVELETYKQSRQGLDEMYNEVWRQLKEEKKVRMELERE
LELQVGLKQEMELAMKLLEKDTHEKQDTLVALRQQLDEVKTLNLQMANKMQNAEISVQQK
NEMIHYLEEKANQTILTIKQMEERLQQSEKARQQAEEKNENTKQEFKSRIEALQQQFTEL
NKHCSSLEREVKAEKEQRQNLQRELQRERETAAQMKTQLQQFSGLQKELEVLQDEKKEFQ
KVCEDQEQALQEMGLHLSQSKLKMEDIKEVNKALKGHTWLKDDEATQCKQCQKEFSISRR
KHHCRNCGGIFCNSCSSNELALSSNPKPVRVCDICHTFLLQRCTSTSS
Download sequence
Identical sequences H3A767
XP_006007930.1.90931 ENSLACP00000005488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]