SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006210 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006210
Domain Number 1 Region: 54-219
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.38e-23
Family Canonical RBD 0.01
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000006210
Domain Number - Region: 250-328
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00435
Family Double-stranded RNA-binding domain (dsRBD) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006210   Gene: ENSLACG00000005507   Transcript: ENSLACT00000006262
Sequence length 330
Comment pep:known_by_projection scaffold:LatCha1:JH129400.1:170821:179353:1 gene:ENSLACG00000005507 transcript:ENSLACT00000006262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERSARENRQGIDALNAENKAALEMWLKETGISLVQINGQRKYGGPPPGWTDPSPPSGCEV
YIGKIPQDLYEDKLIPLFQSVGQLYEFRLMMTFSGHNRGFAYAKYANRRSAQAAITALNR
YELQKDCYILVCRSTEKCELSVDGLPRTQDKEVVCSLLKTITQGVVSVMLYPSLEKNLKR
LAVVKYESHRAAAMAKKALIEGPLELWGHQVEVDWLKSETKQKLKMTRLSLADLKLQFSD
IHRNAQSICGNEVAQLNTFCFKKRLGIPAYVIQSCGIRLEGRELFDFQVSIPGFSIPFRG
SMWVSAENLMNGQEEVKRSAAQQILIYLGE
Download sequence
Identical sequences H3A989
ENSLACP00000006210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]