SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006366 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006366
Domain Number 1 Region: 460-726
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-81
Family Protein kinases, catalytic subunit 0.0000216
Further Details:      
 
Domain Number 2 Region: 298-416
Classification Level Classification E-value
Superfamily PH domain-like 3.02e-32
Family Pleckstrin-homology domain (PH domain) 0.0000162
Further Details:      
 
Domain Number 3 Region: 138-196
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.39e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 7-64
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006366   Gene: ENSLACG00000005649   Transcript: ENSLACT00000006419
Sequence length 787
Comment pep:known_by_projection scaffold:LatCha1:JH128496.1:178034:250322:-1 gene:ENSLACG00000005649 transcript:ENSLACT00000006419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASATFEDFQIRPHTLFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGFNYHKRCAFKIP
NNCSGVRKRRLSNVSLTGLTTTRSASAEPSPSPSDEALLSPLSPGLEQKSPSESFIGREK
RSNSQPFIGRPIQLDKILLSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCK
FNCHKRCAPKVPNNCLGEVAINGDLLSPGAESDVVMEEGSDDNDSERNSNLMDDMEESLA
HHSEISATGSHSDIGDMQDHDPDHDDANRMISPSTSNNIPLMRVVQSVKHTKRKSSSVMK
EGWLVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSKYYKEIPLSEILSLEPAKDFSLLPS
GANSHCFEITTANIVYYVGENLTNLVSSPVTSNVLISGTGLDVARMWEMAIQHALMPVNP
KGASSGSGQNQHRDISVSISVSNCQIQENVDISTIYQIFPDEVLGSGQFGIVYGGKHRKT
GRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGD
MLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKL
CDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNE
DEDIHDQIQNAAFMYPPNPWKEISQEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTW
LDLRELECKIGERYITHESDDTRWEQFAGQHGLQYPAHLINRDVSYSESTESEETEMKAL
SERVSIL
Download sequence
Identical sequences H3A9P5
ENSLACP00000006366 ENSLACP00000006366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]