SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006587 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006587
Domain Number 1 Region: 11-307
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.79e-61
Family FMN-linked oxidoreductases 0.0017
Further Details:      
 
Domain Number 2 Region: 346-454
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.93e-30
Family Double-stranded RNA-binding domain (dsRBD) 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006587   Gene: ENSLACG00000005839   Transcript: ENSLACT00000006640
Sequence length 484
Comment pep:known_by_projection scaffold:LatCha1:JH128976.1:188111:312463:1 gene:ENSLACG00000005839 transcript:ENSLACT00000006640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQSASNLYYRNKTILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMLQCRRVINDVLE
TVDYVAPDGRIIFRTCSRERDRVIFQMGTADPERALTVAQLVENDVAGIDVNMGCPKEYS
TKGGMGAALLSNPDKIESILSILVKGIRRPVTCKIRILPNLEDTLALVKRIENTGVAAIA
VHGSLPRKKDERPQHPVHCDVVKAISEAVSIPVIANGGSHDHIKEFPDIDSFQQATNAAS
VMLARAAMWNPSIFRKEGLQPLETVIRKYIKYAVKYDNNHTNTKYCLCQMLREQLETPRG
KKLHAAQSTQEICEVFEMEEFYKETMAMLDKRKAEVEARKQEVDDLSEEADVIKMAVRFD
KRNYPPQVTPKMYLLEWCRKQNLPQPVYETVQRPQDRSFSSTVIVAEKKYKSTFWEKSKK
LTEQAAAITCLRTLGLPEGKLSEEKSLIHKRKRDDKEGWNGTGDPDDLSVEAVHKKHSIA
QKNN
Download sequence
Identical sequences H3AAB6
ENSLACP00000006587 ENSLACP00000006587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]