SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006622 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006622
Domain Number 1 Region: 73-405
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-80
Family Protein kinases, catalytic subunit 0.0000027
Further Details:      
 
Domain Number 2 Region: 1011-1079
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.73e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 1097-1213
Classification Level Classification E-value
Superfamily PH domain-like 0.000000293
Family Pleckstrin-homology domain (PH domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006622   Gene: ENSLACG00000005873   Transcript: ENSLACT00000006676
Sequence length 1713
Comment pep:known_by_projection scaffold:LatCha1:JH126569.1:190122:329352:1 gene:ENSLACG00000005873 transcript:ENSLACT00000006676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKVRLKKLEQLVLDGPQKNESAMSVETLLDILICLYKECSNSPLRREKYVNEFLEWAK
PFTNLVKDMRLHRDDFEIIKVIGRGAFGEVAVVKMKNTERVYAMKILNKWEMLKRAETAC
FHEERNVLVNGDCQWITTLHYAFQDDNYLYLVMDYYVGGDLLTLLSKFEDRLPEDMAKFY
VAEMVLAIHSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNTDGSVQSSVAVGTP
DYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERF
QFPSHITDVSEDAKDLIQQLICRRERRLGQNGIGDFKKHPFFVGIDWDNIRNRGAPYIPE
VSSPSDTSNFDVDDDVLKNPEIVPPASHTGFSGLHLPFVGFTYTTESCLSDRGNMKGAIH
GTAVADTDVQRDLENSLQVEAYERRIRRLEQEKLELTRKLQESTQTIQSLHGSPRGLGSV
NRDKEIKKLNEEIERLKKKLADSDRLEQKLEDAVTLQQEYEDSTIKLKVLEKQVKTLKQD
KEDIHKQLVEALERLKSQAKELKDAHQQRKLAMQEFSELNETMADLRSQKQKFSRQLRDK
EEEMEVVMQKIDTMRQEIRKAEKARKELEIQLEDTTAEASKERKLREHSELYSKQLESKL
EALKVRQGGRTAGDASEHQQELSKIKSELEKKILFYEEELLRREASHASEIKNLKKEMHD
TESQTLAQQKEIMMLKDKLEKARRERQSEMEEAVGTLKDKYLREKNMLIEENKKLTVETD
RLGSFVDKLTSENRQLEDAFQDLATKKESVAHWEAQIAEIIQWVSDEKDARGYLQALASK
MTEELESLRSSSLGSRTLDPLWKVRRSQKLDMSARLELQSALDAELRAKQLVQEELRKVK
ASNISYESKLKEADTRNRQLLEEVEALKKEIEESRSRADKGLKLPDFQDSIFEYFNTSPL
THDLTFRTSSITEPDASGTKPEVPLSPSVSVPTEQQDEPIKVQHTAPSVPVPSRSTSINI
PKPRAHQLTVKNFSSPTQCSHCTSLMVGLVRQGYACDVCSFTCHVSCKDSTPQVCPVPPE
QAKRPLGIDVQRGIGTAYKGYVRIPKPTGVKKGWQRAYAFVCDCKLFLYDVPEGKSTQCG
VVASQVLDLSRDKEFSVSSVLASDVIHATRKDIPCIFRVTSSLLASPSKTYSLLILTESE
TEKRKWVGILEGLQTILYKNKLRNRPVHVAQEAYDSTLPLIKTTLAAAIIDRDRVALGTE
EGLFVVEVTRDVITRAADCKKVYQIELVSKDKIVILICGRSHHVHLYPWTSLDGSEGSFD
IKLPETKGCQIITTGTLRQGILTCLFVAVKRQVLCYEINRTKPFHKKFNEVQAPGIVQWM
AMFKDKLCVGYQSGFSLLNIQGDGPSVSLVNPNDASLAFLSQCPVDALCAMELVNEEYLL
CFSHMGVYVDLQGRRSRTQELMWPATPVACSCSLSFVTVYSDYGVDVFDANTMEWVQTIA
LRKIRPLNIDGTLNLLNSEPPRLIYFKNSYSEGKELCVPETSDNSKKQMLRTRSKRRFIF
KVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLMGRPIVSKI
KRHPAAVSAVFKLKHAHSHFINSENSGAGDLGGATSSRNISEFEPDFEKEPDSDSTKHST
PSNSSNPSGPPSPNSPHRSQLTLDGLDQSTCDA
Download sequence
Identical sequences H3AAF1
ENSLACP00000006622 ENSLACP00000006622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]