SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006694 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006694
Domain Number 1 Region: 1075-1233
Classification Level Classification E-value
Superfamily RNase III domain-like 6.8e-40
Family RNase III catalytic domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 846-875,933-1046
Classification Level Classification E-value
Superfamily RNase III domain-like 6.28e-38
Family RNase III catalytic domain-like 0.00062
Further Details:      
 
Domain Number 3 Region: 1222-1309
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.47e-16
Family Double-stranded RNA-binding domain (dsRBD) 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000006694
Domain Number - Region: 154-165
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006694   Gene: ENSLACG00000005937   Transcript: ENSLACT00000006748
Sequence length 1347
Comment pep:known_by_projection scaffold:LatCha1:JH127909.1:192905:322057:-1 gene:ENSLACG00000005937 transcript:ENSLACT00000006748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLPSLKGTMSYHSVRGCPFGRGGAGPQLSTQSFQPQNLRPIQHQHPQPPPQYHYEQKNA
PSASFSNTSGAGYVPTRSDFVPYPPPVPLSGQSAVNACPPPPPFASSQARQGFPGPPCFL
PAPPPMQNASNNVPAPGAAPAGQSSFPYMMLSVPPPPLPHPPPPPMMPQQMHYQPSYSMG
YMQQPFAPPNFNAGYQQSSSSSQSDHLFRHASQYQADKSQNNRRSPERGKACDEHRRRGY
GHSSHGDRHRSDYHGDRRERGRSPDRKRREVSRHRPDYERGRSPPRHRSRDRSRWDEGER
YRHRDSRRSTSPERSYRKDHKRVKSRSNSRERKRLRREDDKERWPESRGCIKEKSYTSIK
DKEPEESHPEKPEDEDEEMLKPVWVRCTHDENYYSNDPMDQVGDSTVVGTSKLRDLYEKF
EEELGKRQTKAKAARPPWEPPKTKLDEDLADSSSDSECDSDGDSSCSSSSDSEVFDVIAE
IKRKKAHPDRLHEELWYNDPGQMNDGPLCKCSAKARRTGIRHSIYPGEEPVKCCRAMTNN
AGKLYHYRITVSPPTNFLTDRPTVIEYDDHEYIFEGFSMFSHTPLSNIPLCKVIRFNIDY
TIHFIEEMMPENFCLRGLELFSSYLFRDILELYDWNLIGPEFENSGSWCPKFHFLPRFVR
FLPDGGKEVLSMHQVLIYLLQCNKALVPEEEIANMLQWEELEWQKYAEECKGMIVTNPGM
KPSSVRIDQLDREQFNPDVITFPIIVHFGIRPAQLSYAGDPQYQKLWKSYVKLRHLLANS
PKVKQADKQKLAQREEALQKIRQKNTMRREVTVELSSQGFWKTGIRSDVCQHAMMLPVLT
HHIRYHQCLMHLDKLIGYVFRDRCLLQLAMTHPSHHLNFGMNPDHARNSLSNCGIRQPKY
GDRKVHHMHMRKKGINTLINIMSRLGQDDPTPSRINHNERLEFLGDAVVEFLTSVHLYYL
FPNLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHGPDLCRESDLRHAMANCFEAL
IGAVYLEGGLEEAKQLFGRLLFNNEDLREVWLNYPLHPLQLQEPNTDRQLIETSPVLQKL
TNFEIAIGVNFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFP
DHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYAITNDKTKRPVALRTKTLADLLESFIAA
LYIDKDLEYVHTFMNVCFFPRLKEFILNQDWNDPKSQLQQCCLTLRTEGKEPDIPLYKTL
QTVGPSHARTYTVAVYFKGERIGCGKGPSIQQAEMGAAMDALEKYNFPQMAHQKRFIERK
YRQELKEMRWERERQEKESDEIEEIRN
Download sequence
Identical sequences H3AAM3
ENSLACP00000006694 ENSLACP00000006694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]