SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006940 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006940
Domain Number 1 Region: 18-58
Classification Level Classification E-value
Superfamily WW domain 0.000000000032
Family WW domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006940   Gene: ENSLACG00000006160   Transcript: ENSLACT00000006999
Sequence length 127
Comment pep:novel scaffold:LatCha1:JH128204.1:204247:205038:-1 gene:ENSLACG00000006160 transcript:ENSLACT00000006999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLTPFSLIFFFFSPDPFWNRNSFETDSDLPAGWMRVRDTSGTYYWHIPTGTTQWEPPSP
LCEDQGSRKPSAISQTTTPSEEQQVRPEVCATRCGAVCLSVSWWPVPPPSGAELPNPPPL
PSSSGLP
Download sequence
Identical sequences H3ABB9
ENSLACP00000006940 ENSLACP00000006940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]