SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007184 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007184
Domain Number 1 Region: 199-518
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.7e-52
Family Diacylglycerol kinase-like 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000007184
Domain Number - Region: 49-91
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000663
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.022
Further Details:      
 
Domain Number - Region: 786-838
Classification Level Classification E-value
Superfamily TIMP-like 0.00589
Family Netrin-like domain (NTR/C345C module) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007184   Gene: ENSLACG00000006375   Transcript: ENSLACT00000007244
Sequence length 911
Comment pep:known_by_projection scaffold:LatCha1:JH127123.1:214968:255370:-1 gene:ENSLACG00000006375 transcript:ENSLACT00000007244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFTKEEIMDRNLIVWTTLSVVLPVLITLWCSSQRSKRNMLIKNIFRESQHGWHYTDLFNK
PTYCCICTQHILQGAFCVCCGVCVDEECLKEADKHFECKAIMMAGQEDDSMAHHWVRGNV
PLCSCCIVCRQQCGTQPKLCDYRTLPDNDKCNFGEFRNLIIPPRYLYNINQMRKYHTLNH
RKEFLSNIYIIKKGKSWSPLIVLANTRSGNNMGEALLGEFKILLNAVQVFDLNTISPIKA
LQLCTYLPNNSARVLVCGGDGTVGWVLDAIDEMKIKNKPLTYVAILPLGTGNDLANTLGW
GAGYAGEIPVEQILKNVMEADTVKLDRWKVQVTNKGYYTLRKPKVMSMNNYFSVGPDALM
ALNFHAHREKAPSLFSSRIVNKAVYFLYGTKDCLVQECKDLNKKIELELDGERLELPNLE
GIIVLNIGYWGGGCRLWEGMGDEPFPLARYYDGLLEVVGVYGSFHCAQIQVKLANPVRLG
QAHTVRLTILILKSSRMPMQVDGEPWEQGPCTITITHKTHAQCGIHNICYIVILGGVLVI
IFTVRNSYWNEKQPYFIYWRGQIISWAGCRAHSCRDCFDPVTRPDHPLSQAMRDLGAGQF
NHYACPMFCMEFYPYQVLQTDVTGGEGKLRVTPTGWQKNLNNFLTNIISGLSREPHSRAV
EQIHLRCTEGSLEWMYPTQALRVILEPNLSTSKHTTVCIKPFGNFKGANIYIERKGELDL
LVNEEEKELKHVYCFRAEKPHRVALFLQASLQRDISRRTVGFQYELLNNQSIAPHFHTIT
LLEAACRPCNNTELLIAICSSNFVVQGSIKNVTHDPEHQMSWVEVSASKIYRQKNNIFQH
DETTGEWKGLIKTMLQCRVKRGDGQFLFTGSEHFGDAWLGCAPRYKDFISVYQAAREKKA
NQCEFQNVFNC
Download sequence
Identical sequences H3AC13
ENSLACP00000007184 ENSLACP00000007184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]