SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007251 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007251
Domain Number 1 Region: 602-846
Classification Level Classification E-value
Superfamily vWA-like 1.15e-75
Family Trunk domain of Sec23/24 0.00000574
Further Details:      
 
Domain Number 2 Region: 252-296,441-520,847-941
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.83e-60
Family beta-sandwich domain of Sec23/24 0.00054
Further Details:      
 
Domain Number 3 Region: 1048-1196
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.06e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 4 Region: 943-1047
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 8.63e-27
Family Helical domain of Sec23/24 0.0013
Further Details:      
 
Domain Number 5 Region: 519-601
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 2.09e-23
Family Zn-finger domain of Sec23/24 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007251   Gene: ENSLACG00000006431   Transcript: ENSLACT00000007311
Sequence length 1197
Comment pep:known_by_projection scaffold:LatCha1:JH127098.1:217775:314238:-1 gene:ENSLACG00000006431 transcript:ENSLACT00000007311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPMQNQMQLPAGYGATLQNYSASPGHYSQVPNKVIPSSMTQQYGGDYYPSSYQMSPQNSM
RSTMGSAALGVPQGALVASQTLGLSQGFSQGGMATSSGFLYTPASQPVGYTTSGGHYGSS
VSYPAASASQGVRSQPGHDAMHTGPKAVYPNFSRPSMPLSNQYGQALTSQAPPNPSQIAA
GVLAAQATPLSSAPLQRDPSRHVPMSTWPSSTTMSAPPTLSKSYTGSSSVNSQGTAGGGI
THNCIPNLVNQNYPLPKPAMGPPPASGTPPIRPPPPAAASTPSSGSPAPPHPATPPSGLE
SRMQYGYVANSRTSSAQSPLSSSSDDEEEEEDEEAGADTSSTTSSASSVPNNYDALEGGG
YPGARKSTERREINTKEREQKANKPTQGYIFKHLLKRFQSTFIXPPVSAAFPCSHPVRFH
FKEPYSGVNQLSTTMGGLSMYNLQQPESLRPVNLMQERNVLPPTPVQIPVPNLNPDLKKL
NCSSDSFRCTLTNIPQTQAMLNKAKLPLGLLLHPFRDLTQLPVITSSTIVRCRSCRTYIN
PFVSFLDQRRWKCNLCFRVNDVPEEFMYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLR
PPQPAVYLFVLDVSHSAVEAGYLNVVCHLLLENLDKLPGDSRTRIGFITFDSTIHFYNLQ
EGLSQPQMLIVSDIDDIFIPTPDSLLVNLHESKELVKDLLNALPHMFTDTRETHSALGPS
LQAAYKLMAPTGGRISVFQTQLPSLGAGLLHSREDPNQRSSTKKKGVQHLGPATDFYKKL
ALDCSGQQIAVDLFLLSSQYSDLASLACISKYSAGSIYYYPSFHHIHNPSQTERLQKDLK
RYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLANVNPDSGFAVQMSIEESLT
DTSLACFQAALLYTSSKGERRIRVHTLCLPVVNSLTDVYAGADVQAVICLLANMAVDRSV
SSSLPDAKDALMNAAIDSLSAYQSTVSNPQVSALIAPYSLRLFPLFILALLKQKAFRTGT
STRLDDRVFAMCEIKCQPLVHLLRMIHPNLYRIDRLTEEGTIHFNDKVVPQPPLQQLSAE
RLTKEGAFLMDCGAFLYLWVGKNCDNTYVTEVLGCPNYASIPQTMMELPELDTPLSERTR
GFISWLRDSRTLNPVLHVIRDDSPAKNIFFQHLIEDRTEAAFSYYEFLLHIQQQISK
Download sequence
Identical sequences H3AC80
ENSLACP00000007251 ENSLACP00000007251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]