SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007478 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007478
Domain Number 1 Region: 119-155
Classification Level Classification E-value
Superfamily WW domain 0.000000000000092
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007478   Gene: ENSLACG00000006628   Transcript: ENSLACT00000007540
Sequence length 168
Comment pep:novel scaffold:LatCha1:JH127102.1:227772:262922:-1 gene:ENSLACG00000006628 transcript:ENSLACT00000007540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYYGTPKPPAEPAPLLLNVTDQILPGARPSAEGKRKRNKSVSNMEKAGIDPPEEEEEERP
VVNGNGVAITPESSEHEDKSTDASGDISSQPYAAPVYNQPEESKEEGDPKKPVKPEENDE
LGTLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKED
Download sequence
Identical sequences H3ACV7
ENSLACP00000007478 ENSLACP00000007478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]