SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007486 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000007486
Domain Number - Region: 7-73
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0366
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007486   Gene: ENSLACG00000006637   Transcript: ENSLACT00000007549
Sequence length 308
Comment pep:known_by_projection scaffold:LatCha1:JH127989.1:228071:329010:1 gene:ENSLACG00000006637 transcript:ENSLACT00000007549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPTAPPTYAEAMAGTKDQPYPAQPCTTQQPLPPPPPAVPIHPSWAFVHPNPSPGYSNP
YGADMYSPYSDPSSSGSCDGFTVENWDDKNIRRMFIRKVYTILMVQLMMTFGVVAVFTFC
EPVRLYVQYNRALYFASYAIFLSTYLALVCCSGVRRRYPWNLILLSVFTLAMSYMAGMLA
SYHNTKSVMLCIGITAMVCLCVTLFCFQTKFDFTSCHGLMFAVMMALFLTGLVMVFTVPF
GYIPWLQTVYAGLGALAFTLFLAYDTQLLIGNRRYSLSPEEHVFGALCLYMDIVYIFIFL
LQLFGSRE
Download sequence
Identical sequences H3ACW5
ENSLACP00000007486 XP_006006956.1.90931 XP_014350592.1.90931 XP_014350593.1.90931 XP_014350594.1.90931 ENSLACP00000007486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]