SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007530 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007530
Domain Number 1 Region: 333-394
Classification Level Classification E-value
Superfamily FF domain 2.22e-18
Family FF domain 0.0000266
Further Details:      
 
Domain Number 2 Region: 549-621
Classification Level Classification E-value
Superfamily FF domain 0.000000000000769
Family FF domain 0.0046
Further Details:      
 
Domain Number 3 Region: 147-181
Classification Level Classification E-value
Superfamily WW domain 0.00000000000356
Family WW domain 0.00046
Further Details:      
 
Domain Number 4 Region: 690-752
Classification Level Classification E-value
Superfamily FF domain 0.0000000000118
Family FF domain 0.000035
Further Details:      
 
Domain Number 5 Region: 466-541
Classification Level Classification E-value
Superfamily FF domain 0.0000000000122
Family FF domain 0.0049
Further Details:      
 
Domain Number 6 Region: 188-220
Classification Level Classification E-value
Superfamily WW domain 0.00000000089
Family WW domain 0.0013
Further Details:      
 
Domain Number 7 Region: 399-468
Classification Level Classification E-value
Superfamily FF domain 0.0000000107
Family FF domain 0.0042
Further Details:      
 
Domain Number 8 Region: 13-122
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000000837
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007530   Gene: ENSLACG00000006676   Transcript: ENSLACT00000007594
Sequence length 902
Comment pep:known_by_projection scaffold:LatCha1:JH127320.1:230270:314210:1 gene:ENSLACG00000006676 transcript:ENSLACT00000007594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTDGTNGPGQPVPFQNGPPLMPPPFMGPPGMPPHFPHMGMPSMGQRPPMPPIPPGMMP
PMLPSMGGPPMGQMPGMIPPMMPGMMMPHIPPGPIQPTVLPGVNKPDVPVGSAVPPNQTT
NPAIVSVQQASIACSSPKEEPTKKKSLWTEHKSPDGRIYYYNIETKQSTWEKPDELKTPA
EQMLSKCPWKEYKSDTGKSYYYNSQTKESRWTKPKELEDLEAMIRAEEDGKQEENLASLN
STPSSMTETPAATTTIENSAQASPAIVATETTEEQKEEKEEEEQQQQQEEVAVKDVEEPA
ETTPEPEEETSKQEAIEKEIPKKEEEKTEPVRKTYTWNTKEEAKQAFKELLKEKRVPSNV
SWEQAMKMIINDPRYSALSKLSEKKQAFNAYKVQTEKEEKEEARLKYKEAKEAFQRFLEN
HEKMTSTTRYKKAEQMFRELEVWNAISERDRLEIYEDVLFFVARKEKEQAKQLRKRNWEA
LKNILDNMANVTYCTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEED
EEKQKTLMRERRRQRKNREAFQTFLDELHDHGQLHSMSSWMELYPTISADIRFTNMLGQP
GSTALDLFKFYVEDLKARYHDEKKIIKDILKDKNFVVEVKTAFDEFGSVISLDKRATTLD
AGNIKLAFNSLLEKAEAREREREKEEARKMKRKESVFKSMLKQAAPPIEPGAVWEEIRER
FVKEPAFEDITLESERKRIFKDFLHVLENECQHHHSKTKKHSKKSKKHHRKRSRSRSGSE
SEEEESHSKRKKRSSSKSDSERSSSLESERSYKKSKRHKKKSKKRRHRSMSPDSEGEREK
ERREKEKVSEKDRNKPKSESTKSPRKKTGKDSGNWDSSGSELSEGELEKRRRTLLKQLDD
DQ
Download sequence
Identical sequences H3AD09
ENSLACP00000007530 ENSLACP00000007530 XP_006002135.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]