SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007646 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007646
Domain Number 1 Region: 127-186
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000007646
Domain Number - Region: 167-175,207-226,376-427
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00105
Family Cytochrome c3-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007646   Gene: ENSLACG00000006776   Transcript: ENSLACT00000007710
Sequence length 448
Comment pep:known_by_projection scaffold:LatCha1:JH127067.1:235881:284787:-1 gene:ENSLACG00000006776 transcript:ENSLACT00000007710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYDEKLARFRQGHLNPFNRESTREDPTQADGDLSQNDEPKRALQSKLEIHSSDRVMDLG
LAEDHFSRPVGLFLVSDVNQLKQAIEECKRQILELPEHSEQQKDAVVKLIHLRLKLQELE
DPDEDEPNVRLLQEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYRCHSKCLNL
ITKSCVKSKVSHQSEYELNICPESGLDSQDYRCAECRTLISLRGVPSEARQCDYTGQYYC
PNCHWNDTDVIPARAIHNWDFEPRKVCRSSMRYLALMMSRPVLKLRDLNPLLFNYVEELM
EIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHFVENDDMYSLQDLLDLSSGKLSCS
LTEIHTTFAKHIKLDCEKCQAKGFMCELCKEGDILFPFDSHSSVCSDCSAVFHRDCYYDN
STACPRCMRLQTRKQSLFQPASPSGLQE
Download sequence
Identical sequences H3ADC5
XP_005999254.1.90931 XP_005999255.1.90931 XP_014345828.1.90931 ENSLACP00000007646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]