SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007683 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007683
Domain Number 1 Region: 147-190,218-379,465-514
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.62e-43
Family Glycerol-3-phosphate transporter 0.091
Further Details:      
 
Domain Number 2 Region: 633-778
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.14e-19
Family Glycerol-3-phosphate transporter 0.055
Further Details:      
 
Domain Number 3 Region: 538-620
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000366
Family Pentapeptide repeats 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007683   Gene: ENSLACG00000006807   Transcript: ENSLACT00000007747
Sequence length 781
Comment pep:known_by_projection scaffold:LatCha1:JH126664.1:237835:338769:1 gene:ENSLACG00000006807 transcript:ENSLACT00000007747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEAFRDRTAFIRGAKDIAKEVKRQAAKKVGKSVDKVQDEYTKRSYTRFEEDDDDDYQPQ
DGYYRGDQQNDEEGASSDATEGHDEDDEIYEGEYQGIPHADSMKSEHLTESQPIASEFKD
FEDLEGERKKDKEELAQQYEMILQECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSA
EKDMCLSDSNKGMLGGAPQPALPVVKFMYVRVRPLSFFAVLGLIVYLGMMVGAFLWGGLA
DKIGRRQCLLICLSVNSVFAFFSSFVQGYGTFLFCRLFSGVGIGGSIPIVFSFFSEFLAQ
EKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVA
AIAALTTMPESPRFYLEVTELGMSGNGKGKHFLEVMDENFLDQNGKHDEAWMILKQVHDT
NMKAKGHPERVFSVTHIKTVKQEDELIEIQADTGSWHRRWMVRIMTLGHQVWTNFLQCFS
PEYRRTTLMMMAVWFTMSFSYYGLTVWFPDMIKYLQNKEYASRTKVFYREKVEHFTFNFT
LENQIHKNGEYFNDKFIGLKMKSVVFEDSMFEECYFEDITSSNTFFKNCTFISTLFYNTD
LFEYKFINSKVINSTFLHNKEGCQLDFSDENNAYMIYFVSFLGTLAVLPGNIVSALLMDK
IGRLRMLAGSSVMSCISCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDK
RTTAFGFLNALCKLAAVLGISIFTSFVGITKAVPILLASTALAAGSSLALKLPETRGQVL
Q
Download sequence
Identical sequences H3ADG2
ENSLACP00000007683 ENSLACP00000007683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]