SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007684 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007684
Domain Number 1 Region: 147-373,417-466
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.96e-48
Family LacY-like proton/sugar symporter 0.076
Further Details:      
 
Domain Number 2 Region: 585-730
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.96e-19
Family Glycerol-3-phosphate transporter 0.055
Further Details:      
 
Domain Number 3 Region: 490-572
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000034
Family Pentapeptide repeats 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007684   Gene: ENSLACG00000006807   Transcript: ENSLACT00000007748
Sequence length 733
Comment pep:known_by_projection scaffold:LatCha1:JH126664.1:237835:338769:1 gene:ENSLACG00000006807 transcript:ENSLACT00000007748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEAFRDRTAFIRGAKDIAKEVKRQAAKKVGKSVDKVQDEYTKRSYTRFEEDDDDDYQPQ
DGYYRGDQQNDEEGASSDATEGHDEDDEIYEGEYQGIPHADSMKSEHLTESQPIASEFKD
FEDLEGERKKDKEELAQQYEMILQECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSA
EKDMCLSDSNKGMLVFAVLGLIVYLGMMVGAFLWGGLADKIGRRQCLLICLSVNSVFAFF
SSFVQGYGTFLFCRLFSGVGIGGSIPIVFSFFSEFLAQEKRGEHLSWLCMFWMIGGIYAS
AMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVAAIAALTTMPESPRFYLENGKHD
EAWMILKQVHDTNMKAKGHPERVFSVTHIKTVKQEDELIEIQADTGSWHRRWMVRIMTLG
HQVWTNFLQCFSPEYRRTTLMMMAVWFTMSFSYYGLTVWFPDMIKYLQNKEYASRTKVFY
REKVEHFTFNFTLENQIHKNGEYFNDKFIGLKMKSVVFEDSMFEECYFEDITSSNTFFKN
CTFISTLFYNTDLFEYKFINSKVINSTFLHNKEGCQLDFSDENNAYMIYFVSFLGTLAVL
PGNIVSALLMDKIGRLRMLAGSSVMSCISCFFLSFGNSESAMIALLCLFGGVSIASWNAL
DVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAVPILLASTALAAGSSL
ALKLPETRGQVLQ
Download sequence
Identical sequences H3ADG3
ENSLACP00000007684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]