SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007759 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007759
Domain Number 1 Region: 387-464
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.04e-21
Family Double-stranded RNA-binding domain (dsRBD) 0.0000343
Further Details:      
 
Domain Number 2 Region: 75-159
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 9.11e-21
Family Double-stranded RNA-binding domain (dsRBD) 0.0033
Further Details:      
 
Domain Number 3 Region: 288-372
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.19e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.00037
Further Details:      
 
Domain Number 4 Region: 156-258
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000000728
Family Double-stranded RNA-binding domain (dsRBD) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000007759
Domain Number - Region: 570-641
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000104
Family Double-stranded RNA-binding domain (dsRBD) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007759   Gene: ENSLACG00000006873   Transcript: ENSLACT00000007825
Sequence length 689
Comment pep:known_by_projection scaffold:LatCha1:JH127618.1:241952:483262:-1 gene:ENSLACG00000006873 transcript:ENSLACT00000007825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVKVQTTANLSGSTLPSTVQPPSVSSAGSMGLQASVNGSVLASTASCSSPAAGLVDST
ASNNAPASLQDNMANPKEKTPMCLVNELARFNRIQPQYKLLNERGPAHAKIFTVQLTLGE
QTWEAEGSSIKKAQHAAAAKALSETTLPKPSPRPPKNSINSNPGSITPTVELNGLAMKRG
EPAIYRPLDPKPMPNYRANYNFRGMYNQRYHYPVPKIFYVQLTVGSSEFIGEGRTRQAAR
HNAAMKALQVLRNEPIPEKPPQPLVLTIKCSCVAQDEEPKEAEDDKDVNKSEISLVFEIA
LKRNMPVSFEVIKESGPPHMKSFVTRVTVGEFTAEGEGNSKKLSKKRAATAVLQELKKLP
SLPVTEKPKLHFKKRPKTILKTGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPR
RREFVMQVKVGSEVATGTGPNKKVAKRNAAEAMLLQLGYKASTPVQNQPEKSSENKGWNG
QKPTFSEQASNTQKGILHLSPDVYQEMEASRNKAAPGTTINYLTSKEMSQGSSSYFSNTS
NTATIARELLLNGTSPTAEAIGLKGKTPVSPCSAVQPFQQLEYLARIQGFQVQYSDRQNG
KECMTYLTLSPVQMTFHGIGSSIEASHDQAALSALKQLSEQGLDPVEGAIKVENGSLEKQ
VKHLGERGDNKQTNSGTNAQDCKDSKAVV
Download sequence
Identical sequences H3ADN8
XP_014349083.1.90931 ENSLACP00000007760 ENSLACP00000007759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]