SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008002 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008002
Domain Number 1 Region: 334-627
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-74
Family Protein kinases, catalytic subunit 0.00000000303
Further Details:      
 
Domain Number 2 Region: 52-127
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-24
Family Ras-binding domain, RBD 0.0000361
Further Details:      
 
Domain Number 3 Region: 126-180
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000478
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008002   Gene: ENSLACG00000007082   Transcript: ENSLACT00000008068
Sequence length 643
Comment pep:known_by_projection scaffold:LatCha1:JH127608.1:254510:295106:1 gene:ENSLACG00000007082 transcript:ENSLACT00000008068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHLQRAWNGFGVKDSVFDGSTCMSPTIVEPFAYARRASDDGKLMDHSRASTTIRVYLPH
KQRTVANVRNGMTLQDCLIKALKVRGLQPECCAVFRLVHGQRGRRFRVDWNTDATSLIGE
ELQVDFLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMC
VDWSNIRQMLLFPNSNIGDSGVPSLPSLTTRRMRESLSRFSVSYEHRHSTPHAFNFNPAT
PAPEGSLSRRQRSTSTPNVHMVSTTMPVDSRVIEDAIRSHNESVSPSALSGSPPSLSPTG
WSQQKTPVPAHREKAPGSSTQEKNKIRSRVQRDSSYYWEIEASEVMLLTRIGSGSFGTVY
KGKWHGDVAVKILKVTDPTPEQFHAFRNEVAVLRKTRHVNILLFMGYMTKGNLAIVTQWC
EGSSLYKHLHVQETKFQMIQLIDIARQAAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKI
GDFGLATVKSRWSGSQQVEQPSGSILWMAPEVIRMQDNNPYSFQSDVYSYGIVLYELMTG
ELPYSHINNRDQIIFMIGRGYLSPDLSKLYKNCPKAMKRLVADCVKKTREDRPLFPQVLS
SVELLQHSLPKINRSASEPSLHRVTQTEDINSFTLTSTRLPVF
Download sequence
Identical sequences H3AED1
ENSLACP00000008002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]