SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008007 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008007
Domain Number 1 Region: 137-203
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.1e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0000496
Further Details:      
 
Domain Number 2 Region: 250-330
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000000487
Family Double-stranded RNA-binding domain (dsRBD) 0.025
Further Details:      
 
Domain Number 3 Region: 22-74
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000754
Family Double-stranded RNA-binding domain (dsRBD) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008007   Gene: ENSLACG00000007087   Transcript: ENSLACT00000008073
Sequence length 336
Comment pep:known_by_projection scaffold:LatCha1:JH126659.1:254646:271563:1 gene:ENSLACG00000007087 transcript:ENSLACT00000008073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRPEAAPPGATGHAPPAIEQMLASNPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQ
PNFTFRVTVGDINCTDFSASFGGGGCCLEGGGDFSASLWGGEGERESESPLLSPTALFCI
TWSFSNNNNNNMLLFNFQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSG
TSKKLAKRNAAAKMLSRIHNVPVDQRDGNEVEVDEDQFSITACCKLEAIKGKTSSCTWDA
LRNSAGEKILHLRNHPLGISSSNFCQLLRELSEEQRFDISYLDIEEMSLSGLYQCLVELS
TQPTTVCHGSASTRDSAHSNAAHKALQYLKIMAGGK
Download sequence
Identical sequences H3AED6
ENSLACP00000008007 ENSLACP00000008007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]